ICT Antibody (6F8)

Images

 
Western Blot: ICT Antibody (6F8) [H00003396-M05] - Analysis of ICT1 expression in HeLa(Cat # L013V1).
Sandwich ELISA: ICT Antibody (6F8) [H00003396-M05] - Detection limit for recombinant GST tagged ICT1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ICT Antibody (6F8) Summary

Immunogen
ICT1 (NP_001536, 107 a.a. - 206 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ICT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ICT Antibody (6F8)

  • Digestion substraction 1
  • DS-1DS1
  • EC 3.1.1.29
  • Immature colon carcinoma transcript 1 protein
  • immature colon carcinoma transcript 1
  • peptidyl-tRNA hydrolase ICT1, mitochondrial

Background

The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF5866
Species: Hu
Applications: WB, IHC
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ICT Antibody (H00003396-M05) (0)

There are no publications for ICT Antibody (H00003396-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICT Antibody (H00003396-M05) (0)

There are no reviews for ICT Antibody (H00003396-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICT Antibody (H00003396-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ICT Products

Bioinformatics Tool for ICT Antibody (H00003396-M05)

Discover related pathways, diseases and genes to ICT Antibody (H00003396-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICT Antibody (H00003396-M05)

Discover more about diseases related to ICT Antibody (H00003396-M05).
 

Pathways for ICT Antibody (H00003396-M05)

View related products by pathway.

PTMs for ICT Antibody (H00003396-M05)

Learn more about PTMs related to ICT Antibody (H00003396-M05).

Blogs on ICT

There are no specific blogs for ICT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICT Antibody (6F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ICT1
Uniprot