Hyaluronidase 1/HYAL1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HYAL1. Source: E. coli
Amino Acid Sequence: SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HYAL1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83409. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Hyaluronidase 1/HYAL1 Recombinant Protein Antigen
Background
HYAL1 codes for a protein that may have a role in promoting tumor progression and blocking the TGFB1-enhanced cell growth, and is expressed highly in the liver, kidney, and heart, with weaker expression in the lung placenta, and skeletal muscle. There are seven isoforms of HYAL1, with the longest being isoform 1, which is only expressed in bladder and prostate cancer cells and is 435 amino acids long and weighs approximately 48 kDa. Current studies are being done on several diseases and disorders relating to this gene including lung carcinoma, lysosomal storage disease, diabetes mellitus, ovarian cancer, endometrial carcinoma, prostate cancer, and breast cancer. HYAL1 has also been shown to have interactions with GUSB, ARSB, IDUA, FAM107B, and COL2A1 in pathways such as the metabolic, lysosome, and Maroteaux-Lamy syndrome pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP) (0)
There are no publications for Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP) (0)
There are no reviews for Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP) (0)
Additional Hyaluronidase 1/HYAL1 Products
Research Areas for Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP)
Find related products by research area.
|
Blogs on Hyaluronidase 1/HYAL1