TUSC4 Antibody


Western Blot: TUSC4 Antibody [NBP1-82537] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: TUSC4 Antibody [NBP1-82537] - Immunofluorescent staining of human cell line PC-3 shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-82537] - Staining of human pancreas shows strong cytoplasmic and/or nuclear positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TUSC4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSP GTTVRDLIGRHPQQLQHVD
Specificity of human TUSC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TUSC4 Protein (NBP1-82537PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Alternate Names for TUSC4 Antibody

  • G21 protein
  • Gene 21 protein
  • homologous to yeast nitrogen permease (candidate tumor suppressor)
  • nitrogen permease regulator 2-like protein
  • nitrogen permease regulator-like 2 (S. cerevisiae)
  • NPR2
  • NPR2L2810446G01Rik
  • NPRL2
  • Tumor suppressor candidate 4NPR2-like protein
  • TUSC4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TUSC4 Antibody (NBP1-82537) (0)

There are no publications for TUSC4 Antibody (NBP1-82537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUSC4 Antibody (NBP1-82537) (0)

There are no reviews for TUSC4 Antibody (NBP1-82537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TUSC4 Antibody (NBP1-82537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TUSC4 Antibody (NBP1-82537)

Discover related pathways, diseases and genes to TUSC4 Antibody (NBP1-82537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUSC4 Antibody (NBP1-82537)

Discover more about diseases related to TUSC4 Antibody (NBP1-82537).

Pathways for TUSC4 Antibody (NBP1-82537)

View related products by pathway.

PTMs for TUSC4 Antibody (NBP1-82537)

Learn more about PTMs related to TUSC4 Antibody (NBP1-82537).

Research Areas for TUSC4 Antibody (NBP1-82537)

Find related products by research area.

Blogs on TUSC4

There are no specific blogs for TUSC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TUSC4 Antibody and receive a gift card or discount.


Gene Symbol NPRL2