![Western Blot: TUSC4 Antibody [NBP1-82537] - Analysis in control (vector only transfected HEK293T lysate) and NPRL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/TUSC4-Antibody-Western-Blot-NBP1-82537-img0009.jpg "Western Blot: TUSC4 Antibody [NBP1-82537] - Analysis in control (vector only transfected HEK293T lysate) and NPRL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPRL2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-82537 | Applications | Species |
|---|---|---|
| Barayan R Role of the mTOR Pathway and Autophagy in Mediating PARP Inhibitor Sensitivity in Small Cell Lung Cancer Thesis 2022-01-01 [PMID: 33262410] |
Secondary Antibodies |
Isotype Controls |
Research Areas for TUSC4 Antibody (NBP1-82537)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TUSC4 Antibody [NBP1-82537] - Staining of human cell line PC-3 shows localization to cytosol & microtubules. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUSC4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82537-img0008.jpg "Immunocytochemistry/Immunofluorescence: TUSC4 Antibody [NBP1-82537] - Staining of human cell line PC-3 shows localization to cytosol & microtubules. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-82537] - Staining of human pancreas shows strong cytoplasmic and/or nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/TUSC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82537-img0007.jpg "Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-82537] - Staining of human pancreas shows strong cytoplasmic and/or nuclear positivity in exocrine glandular cells.")
![Western Blot Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Western_Blot_12960.jpg)
![Immunohistochemistry Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Immunohistochemistry_14706.jpg)
![Immunocytochemistry Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Immunocytochemistry_14709.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")