TUSC4 Antibody

Western Blot: TUSC4 Antibody [NBP1-82537] - Analysis in control (vector only transfected HEK293T lysate) and NPRL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: TUSC4 Antibody [NBP1-82537] - Staining of human cell line PC-3 shows localization to cytosol & microtubules. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TUSC4 Antibody [NBP1-82537] - Staining of human pancreas shows strong cytoplasmic and/or nuclear positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TUSC4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPRL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TUSC4 Protein (NBP1-82537PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Alternate Names for TUSC4 Antibody

• G21 protein
• Gene 21 protein
• homologous to yeast nitrogen permease (candidate tumor suppressor)
• nitrogen permease regulator 2-like protein
• nitrogen permease regulator-like 2 (S. cerevisiae)
• NPR2
• NPR2L2810446G01Rik
• NPRL2
• Tumor suppressor candidate 4NPR2-like protein
• TUSC4

Background

Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TUSC4 Antibody (NBP1-82537)(1)

Publication using NBP1-82537

• Barayan R Role of the mTOR Pathway and Autophagy in Mediating PARP Inhibitor Sensitivity in Small Cell Lung Cancer Thesis 2022-01-01 [PMID: 33262410]

Bioinformatics

• Gene Symbol: NPRL2
• Uniprot:
  • Q8WTW4(Human)