Hyaluronidase 1/HYAL1 Antibody

Images

 
Immunohistochemistry-Paraffin: HYAL1 Antibody [NBP1-83409] - Staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hyaluronidase 1/HYAL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HYAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP)
Publications
Read Publications using
NBP1-83409 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23560496)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hyaluronidase 1/HYAL1 Antibody

  • EC 3.2.1.35
  • FUS2
  • HYAL1
  • HYAL-1
  • Hyaluronidase 1
  • Hyaluronoglucosaminidase 1
  • hyaluronoglucosaminidase-1
  • LUCA1
  • luCa-1
  • LUCA1hyaluronidase-1
  • Lung carcinoma protein 1
  • MGC45987
  • NAT6
  • plasma hyaluronidase
  • tumor suppressor LUCA-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14112
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86328
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86355
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009254-M12
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409) (0)

There are no reviews for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hyaluronidase 1/HYAL1 Products

Bioinformatics Tool for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409)

Discover related pathways, diseases and genes to Hyaluronidase 1/HYAL1 Antibody (NBP1-83409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409)

Discover more about diseases related to Hyaluronidase 1/HYAL1 Antibody (NBP1-83409).
 

Pathways for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409)

View related products by pathway.

PTMs for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409)

Learn more about PTMs related to Hyaluronidase 1/HYAL1 Antibody (NBP1-83409).
 

Research Areas for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409)

Find related products by research area.

Blogs on Hyaluronidase 1/HYAL1

There are no specific blogs for Hyaluronidase 1/HYAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hyaluronidase 1/HYAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HYAL1
Entrez