Hyaluronidase 1/HYAL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Hyaluronidase 1/HYAL1 Antibody [NBP1-83409] - Staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Hyaluronidase 1/HYAL1 Antibody [NBP1-83409] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Hyaluronidase 1/HYAL1 Antibody [NBP1-83409] - Staining of human gallbladder shows moderate to strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Hyaluronidase 1/HYAL1 Antibody [NBP1-83409] - Staining of human tonsil shows very weak positivity as expected.

Immunohistochemistry of candidate biomarkers in prostate cancer. Representative immunohistochemical staining of ACPP, ADAM9, ALDH1A2, CASR, CCND1, CCPG1, CD34, CD44, CD44v6, CHGA, CHMP1A, EI24, ENO2, GADD45B, HA, HAS2, HES6, HMMR, HOXC6, HYAL1, IGF1, IQCK, MAP4K4, MKI67, PAGE4, PLIN2, PTEN, SIAH2, SMAD4, SOX9, SPP1, SYP, & TP53 from prostate cancer tissue microarrays. Scale bar represents 50 μm. Image collected & cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-244), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Analysis in human liver and tonsil tissues using NBP1-83409 antibody. Corresponding HYAL1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hyaluronidase 1/HYAL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Hyaluronidase 1/HYAL1 Antibody - BSA Free (NBP1-83409) is a polyclonal antibody validated for use in IHC. Anti-Hyaluronidase 1/HYAL1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HYAL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Hyaluronidase 1/HYAL1 Protein (NBP1-83409PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23560496)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Hyaluronidase 1/HYAL1 Antibody - BSA Free

• EC 3.2.1.35
• FUS2
• HYAL1
• HYAL-1
• Hyaluronidase 1
• Hyaluronoglucosaminidase 1
• hyaluronoglucosaminidase-1
• LUCA1
• luCa-1
• LUCA1hyaluronidase-1
• Lung carcinoma protein 1
• MGC45987
• NAT6
• plasma hyaluronidase
• tumor suppressor LUCA-1

Background

HYAL1 codes for a protein that may have a role in promoting tumor progression and blocking the TGFB1-enhanced cell growth, and is expressed highly in the liver, kidney, and heart, with weaker expression in the lung placenta, and skeletal muscle. There are seven isoforms of HYAL1, with the longest being isoform 1, which is only expressed in bladder and prostate cancer cells and is 435 amino acids long and weighs approximately 48 kDa. Current studies are being done on several diseases and disorders relating to this gene including lung carcinoma, lysosomal storage disease, diabetes mellitus, ovarian cancer, endometrial carcinoma, prostate cancer, and breast cancer. HYAL1 has also been shown to have interactions with GUSB, ARSB, IDUA, FAM107B, and COL2A1 in pathways such as the metabolic, lysosome, and Maroteaux-Lamy syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hyaluronidase 1/HYAL1 Antibody (NBP1-83409)(3)

Publications using NBP1-83409

• Yamamoto T, Suzuki S, Fujii T et al. Efficacy of hyaluronic acid on intervertebral disc inflammation: An in vitro study using notochordal cell lines and human disc cells Journal of orthopaedic research : official publication of the Orthopaedic Research Society 2020-11-29 [PMID: 33251629]
• Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014-04-05 [PMID: 24708576] (IF/IHC, Human)
• Hanna S, Mari P, Kristiina TK et al. Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma. BMC Cancer 2013-04-05 [PMID: 23560496]

Bioinformatics

• Gene Symbol: HYAL1