Hyaluronidase 1/HYAL1 Antibody

Images

 
Western Blot: Hyaluronidase 1/HYAL1 Antibody [H00003373-B01P] - Analysis of HYAL1 expression in human kidney.
Western Blot: Hyaluronidase 1/HYAL1 Antibody [H00003373-B01P] - analysis of HYAL1 expression in transfected 293T cell line by HYAL1 purified MaxPab polyclonal antibody (B01P). Lane 1: HYAL1 transfected lysate (28.00 ...read more
Western Blot: Hyaluronidase 1/HYAL1 Antibody [H00003373-B01P] - Analysis of HYAL1 expression in transfected 293T cell line by HYAL1 polyclonal antibody. Lane 1: HYAL1 transfected lysate(27.83 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hyaluronidase 1/HYAL1 Antibody Summary

Immunogen
HYAL1 (NP_695015.1, 1 a.a. - 253 a.a.) full-length human protein. MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Specificity
HYAL1 - hyaluronoglucosaminidase 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HYAL1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA.
Publications
Read Publication using H00003373-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hyaluronidase 1/HYAL1 Antibody

  • EC 3.2.1.35
  • FUS2
  • HYAL1
  • HYAL-1
  • Hyaluronidase 1
  • Hyaluronoglucosaminidase 1
  • hyaluronoglucosaminidase-1
  • LUCA1
  • luCa-1
  • LUCA1hyaluronidase-1
  • Lung carcinoma protein 1
  • MGC45987
  • NAT6
  • plasma hyaluronidase
  • tumor suppressor LUCA-1

Background

This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14112
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-37494
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-47579
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86355
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-30044
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P)(1)

Reviews for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P) (0)

There are no reviews for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P)

Discover related pathways, diseases and genes to Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P)

Discover more about diseases related to Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P).
 

Pathways for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P)

View related products by pathway.

PTMs for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P)

Learn more about PTMs related to Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P).

Blogs on Hyaluronidase 1/HYAL1

There are no specific blogs for Hyaluronidase 1/HYAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hyaluronidase 1/HYAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HYAL1
Entrez
Uniprot