Hyaluronidase 1/HYAL1 Antibody

Western Blot: Hyaluronidase 1/HYAL1 Antibody [H00003373-B01P] - Analysis of HYAL1 expression in human kidney.

Western Blot: Hyaluronidase 1/HYAL1 Antibody [H00003373-B01P] - analysis of HYAL1 expression in transfected 293T cell line by HYAL1 purified MaxPab polyclonal antibody (B01P). Lane 1: HYAL1 transfected lysate (28.00 KDa). Lane 2: Non-transfected lysate.

Western Blot: Hyaluronidase 1/HYAL1 Antibody [H00003373-B01P] - Analysis of HYAL1 expression in transfected 293T cell line by HYAL1 polyclonal antibody. Lane 1: HYAL1 transfected lysate(27.83 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Hyaluronidase 1/HYAL1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HYAL1 (NP_695015.1, 1 a.a. - 253 a.a.) full-length human protein. MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
• Specificity: HYAL1 - hyaluronoglucosaminidase 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HYAL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hyaluronidase 1/HYAL1 Antibody

• EC 3.2.1.35
• FUS2
• HYAL1
• HYAL-1
• Hyaluronidase 1
• Hyaluronoglucosaminidase 1
• hyaluronoglucosaminidase-1
• LUCA1
• luCa-1
• LUCA1hyaluronidase-1
• Lung carcinoma protein 1
• MGC45987
• NAT6
• plasma hyaluronidase
• tumor suppressor LUCA-1

Background

This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hyaluronidase 1/HYAL1 Antibody (H00003373-B01P)(1)

Publication using H00003373-B01P

• Papakonstantinou E, Kouri FM, Karakiulakis G et al. Increased hyaluronic acid content in idiopathic pulmonary arterial hypertension. Eur Respir J;32(6):1504-1512. 2008-01-01 [PMID: 18768572]

Bioinformatics

• Gene Symbol: HYAL1
• Entrez:
  • 3373(Human)
• Uniprot:
  • NP_695015.1(Human)