Novus Biologicals products are now on bio-techne.com

Hyaluronidase 1/HYAL1 Antibody (2H7)

Images

 
Immunoprecipitation: Hyaluronidase 1/HYAL1 Antibody (2H7) [H00003373-M01] - Analysis of HYAL1 transfected lysate using anti-HYAL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HYAL1 MaxPab ...read more
Sandwich ELISA: Hyaluronidase 1/HYAL1 Antibody (2H7) [H00003373-M01] - Detection limit for recombinant GST tagged HYAL1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
2H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hyaluronidase 1/HYAL1 Antibody (2H7) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
Specificity
HYAL1 (2H7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HYAL1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hyaluronidase 1/HYAL1 Antibody (2H7)

  • EC 3.2.1.35
  • FUS2
  • HYAL1
  • HYAL-1
  • Hyaluronidase 1
  • Hyaluronoglucosaminidase 1
  • hyaluronoglucosaminidase-1
  • LUCA1
  • luCa-1
  • LUCA1hyaluronidase-1
  • Lung carcinoma protein 1
  • MGC45987
  • NAT6
  • plasma hyaluronidase
  • tumor suppressor LUCA-1

Background

This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81283
Species: Hu
Applications: IHC, IHC-P
NBP2-93736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14112
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-27161
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-37494
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-47579
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
6904-GH
Species: Hu
Applications: EnzAct
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-2218
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-81501
Species: Hu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF756
Species: Mu
Applications: IHC, WB
NBP1-82537
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01) (0)

There are no publications for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01) (0)

There are no reviews for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hyaluronidase 1/HYAL1 Products

Research Areas for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01)

Find related products by research area.

Blogs on Hyaluronidase 1/HYAL1

There are no specific blogs for Hyaluronidase 1/HYAL1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hyaluronidase 1/HYAL1 Antibody (2H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol HYAL1
Entrez
OMIM