Hyaluronidase 1/HYAL1 Antibody (2H7) Summary
Immunogen |
HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH |
Specificity |
HYAL1 (2H7) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
HYAL1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoprecipitation
- Sandwich ELISA
|
Application Notes |
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Hyaluronidase 1/HYAL1 Antibody (2H7)
Background
This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01) (0)
There are no publications for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01) (0)
There are no reviews for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hyaluronidase 1/HYAL1 Products
Bioinformatics Tool for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01)
Discover related pathways, diseases and genes to Hyaluronidase 1/HYAL1 Antibody (H00003373-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01)
Discover more about diseases related to Hyaluronidase 1/HYAL1 Antibody (H00003373-M01).
| | Pathways for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01)
View related products by pathway.
|
PTMs for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01)
Learn more about PTMs related to Hyaluronidase 1/HYAL1 Antibody (H00003373-M01).
| | Research Areas for Hyaluronidase 1/HYAL1 Antibody (H00003373-M01)
Find related products by research area.
|
Blogs on Hyaluronidase 1/HYAL1