Hyaluronan Synthase 3/HAS3 Antibody

Images

 
Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [H00003038-B02P] - Analysis of HAS3 expression in transfected 293T cell line by HAS3 polyclonal antibody. Lane 1: HAS3 transfected lysate(31.02 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hyaluronan Synthase 3/HAS3 Antibody Summary

Immunogen
HAS3 (AAH21853, 1 a.a. - 281 a.a.) full-length human protein. MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HAS3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hyaluronan Synthase 3/HAS3 Antibody

  • EC 2.4.1.212
  • HA synthase 3
  • HAS3
  • Hyaluronan Synthase 3
  • Hyaluronate synthase 3
  • Hyaluronic acid synthase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81637
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81283
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-00201
Species: Hu
Applications: Flow, IF, IHC, PEP-ELISA
6507-IL/CF
Species: Hu
Applications: BA
DY413
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
233-FB/CF
Species: Hu
Applications: BA
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
H00003038-B02P
Species: Hu
Applications: WB

Publications for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P) (0)

There are no publications for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P) (0)

There are no reviews for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hyaluronan Synthase 3/HAS3 Products

Bioinformatics Tool for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P)

Discover related pathways, diseases and genes to Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P)

Discover more about diseases related to Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P).
 

Pathways for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P)

View related products by pathway.

PTMs for Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P)

Learn more about PTMs related to Hyaluronan Synthase 3/HAS3 Antibody (H00003038-B02P).

Blogs on Hyaluronan Synthase 3/HAS3

There are no specific blogs for Hyaluronan Synthase 3/HAS3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hyaluronan Synthase 3/HAS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAS3
Uniprot