Hyaluronan synthase 1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAS1. Source: E. coli
Amino Acid Sequence: DGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HAS1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39087. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Hyaluronan synthase 1 Recombinant Protein Antigen
Background
Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide varietyof organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternatingglucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA issynthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extrudedthrough pore-like structures into the extracellular space. It serves a variety of functions, including space filling,lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during woundhealing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serumconcentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. Inaddition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes,and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identifiedvertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homologyto the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and arecently described murine hyaluronan synthase. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, mIF
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for Hyaluronan synthase 1 Protein (NBP2-39087PEP) (0)
There are no publications for Hyaluronan synthase 1 Protein (NBP2-39087PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hyaluronan synthase 1 Protein (NBP2-39087PEP) (0)
There are no reviews for Hyaluronan synthase 1 Protein (NBP2-39087PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Hyaluronan synthase 1 Protein (NBP2-39087PEP) (0)
Additional Hyaluronan synthase 1 Products
Research Areas for Hyaluronan synthase 1 Protein (NBP2-39087PEP)
Find related products by research area.
|
Blogs on Hyaluronan synthase 1