Hyaluronan synthase 1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Hyaluronan synthase 1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-39087PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Hyaluronan synthase 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAS1.

Source: E. coli

Amino Acid Sequence: DGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HAS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39087.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hyaluronan synthase 1 Recombinant Protein Antigen

  • HA synthase 1
  • HAS
  • huHAS1
  • hyaluronan synthase 1
  • hyaluronate synthase 1
  • hyaluronic acid synthase 1

Background

Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide varietyof organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternatingglucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA issynthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extrudedthrough pore-like structures into the extracellular space. It serves a variety of functions, including space filling,lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during woundhealing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serumconcentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. Inaddition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes,and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identifiedvertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homologyto the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and arecently described murine hyaluronan synthase. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-37494
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-82845
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-81283
Species: Hu
Applications: IHC,  IHC-P
NBP1-00201
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
NBP2-93736
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
485-MI
Species: Mu
Applications: BA
233-FB
Species: Hu
Applications: BA
H00005018-D01P
Species: Hu
Applications: ICC/IF, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-85432
Species: Hu, Mu
Applications: COMET, IHC,  IHC-P, mIF
M6000B
Species: Mu
Applications: ELISA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA

Publications for Hyaluronan synthase 1 Protein (NBP2-39087PEP) (0)

There are no publications for Hyaluronan synthase 1 Protein (NBP2-39087PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronan synthase 1 Protein (NBP2-39087PEP) (0)

There are no reviews for Hyaluronan synthase 1 Protein (NBP2-39087PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hyaluronan synthase 1 Protein (NBP2-39087PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hyaluronan synthase 1 Products

Research Areas for Hyaluronan synthase 1 Protein (NBP2-39087PEP)

Find related products by research area.

Blogs on Hyaluronan synthase 1

There are no specific blogs for Hyaluronan synthase 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hyaluronan synthase 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HAS1