HVEM/TNFRSF14 Antibody

Images

 
Western Blot: HVEM/TNFRSF14 Antibody [NBP1-88874] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: HVEM/TNFRSF14 Antibody [NBP1-88874] - Staining of human cell line U-2 OS shows localization to cytosol & rods & rings.
Immunohistochemistry-Paraffin: HVEM/TNFRSF14 Antibody [NBP1-88874] - Staining of human spleen shows weak cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HVEM/TNFRSF14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFRSF14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HVEM/TNFRSF14 Protein (NBP1-88874PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HVEM/TNFRSF14 Antibody

  • ATAR
  • CD270 antigen
  • CD270
  • CD40-like protein
  • Herpes virus entry mediator A
  • Herpesvirus entry mediator A
  • HveA
  • HVEM
  • HVEMTR2HVEAATAR
  • LIGHTR
  • TNFRSF14
  • tumor necrosis factor receptor superfamily member 14
  • tumor necrosis factor receptor superfamily, member 14 (herpesvirus entrymediator)
  • Tumor necrosis factor receptor-like 2
  • tumor necrosis factor receptor-like gene2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45549
Species: Hu
Applications: WB, Flow, IHC
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-20571
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-46228
Species: Hu
Applications: WB, IHC
AF2229
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88874
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HVEM/TNFRSF14 Antibody (NBP1-88874) (0)

There are no publications for HVEM/TNFRSF14 Antibody (NBP1-88874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HVEM/TNFRSF14 Antibody (NBP1-88874) (0)

There are no reviews for HVEM/TNFRSF14 Antibody (NBP1-88874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HVEM/TNFRSF14 Antibody (NBP1-88874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HVEM/TNFRSF14 Products

Bioinformatics Tool for HVEM/TNFRSF14 Antibody (NBP1-88874)

Discover related pathways, diseases and genes to HVEM/TNFRSF14 Antibody (NBP1-88874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HVEM/TNFRSF14 Antibody (NBP1-88874)

Discover more about diseases related to HVEM/TNFRSF14 Antibody (NBP1-88874).
 

Pathways for HVEM/TNFRSF14 Antibody (NBP1-88874)

View related products by pathway.

PTMs for HVEM/TNFRSF14 Antibody (NBP1-88874)

Learn more about PTMs related to HVEM/TNFRSF14 Antibody (NBP1-88874).
 

Research Areas for HVEM/TNFRSF14 Antibody (NBP1-88874)

Find related products by research area.

Blogs on HVEM/TNFRSF14

There are no specific blogs for HVEM/TNFRSF14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HVEM/TNFRSF14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF14
Entrez