HSPC268 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HSPC268 Antibody [NBP2-31902] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody stainign is shown in green.

Immunohistochemistry-Paraffin: HSPC268 Antibody [NBP2-31902] - Staining of human placenta shows weak granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: HSPC268 Antibody [NBP2-31902] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: HSPC268 Antibody [NBP2-31902] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HSPC268 Antibody [NBP2-31902] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSPC268 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSPC268 Antibody - BSA Free (NBP2-31902) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP
• Predicted Species: Mouse (93%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C7ORF55
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HSPC268 Protein (NBP2-31902PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HSPC268 Antibody - BSA Free

• C7orf55
• chromosome 7 open reading frame 55
• FLJ35699
• FMC1
• formation of mitochondrial complexes 1 homolog
• HSPC268

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C7ORF55