Hsp47 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Hsp47 Antibody [NBP1-88172] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Hsp47 Antibody [NBP1-88172] - Staining of human vulva/anal skin shows moderate cytoplasmic positivity in epidermal cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SERPINH1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hsp47 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Hsp47 Antibody - BSA Free (NBP1-88172) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Hsp47 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPINH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Hsp47 Protein (NBP1-88172PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hsp47 Antibody - BSA Free

• (collagen binding protein 1)
• Arsenic-transactivated protein 3
• AsTP3
• BERF-1
• CBP1
• CBP2
• CBP2RA-A47
• Cell proliferation-inducing gene 14 protein
• Collagen-binding protein
• colligen
• Colligin
• colligin-1
• colligin-2
• gp46
• HSP47
• HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
• member 1, (collagen binding protein 1)
• member 2
• member 2, (collagen-binding protein 2)
• OI10
• PPROM
• proliferation-inducing gene 14
• RA-A47
• rheumatoid arthritis antigen A-47,47 kDa heat shock protein
• Rheumatoid arthritis-related antigen RA-A47
• serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
• Serpin H1
• serpin peptidase inhibitor, clade H (heat shock protein 47), member 1
• SERPINH1
• SERPINH2colligin

Background

Hsp47 encodes a member of the serpin superfamily of serine proteinase inhibitors. Its expression is induced by heat shock. The protein localizes to the endoplasmic reticulum lumen and binds collagen; thus it is thought to be a molecular chaperone involved in the maturation of collagen molecules. Autoantibodies to this protein have been found in patients with rheumatoid arthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hsp47 Antibody (NBP1-88172)(1)

Publication using NBP1-88172

• Capone V, Clemente E, Restelli E et al. PERK inhibition attenuates the abnormalities of the secretory pathway and the increased apoptotic rate induced by SIL1 knockdown in HeLa cells. Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease 2018-07-01 [PMID: 30293566] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: SERPINH1