Hsp47 Antibody

Images

 
Western Blot: Hsp47 Antibody [NBP1-88172] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Hsp47 Antibody [NBP1-88172] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.
Immunohistochemistry-Paraffin: Hsp47 Antibody [NBP1-88172] - Staining of human vulva/anal skin shows moderate cytoplasmic positivity in epidermal cells.
Western Blot: Hsp47 Antibody [NBP1-88172] - Analysis in human cell line CACO-2.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hsp47 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Hsp47 Protein (NBP1-88172PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hsp47 Antibody

  • (collagen binding protein 1)
  • Arsenic-transactivated protein 3
  • AsTP3
  • BERF-1
  • CBP1
  • CBP2
  • CBP2RA-A47
  • Cell proliferation-inducing gene 14 protein
  • Collagen-binding protein
  • colligen
  • Colligin
  • colligin-1
  • colligin-2
  • gp46
  • HSP47
  • HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
  • member 1, (collagen binding protein 1)
  • member 2
  • member 2, (collagen-binding protein 2)
  • OI10
  • PPROM
  • proliferation-inducing gene 14
  • RA-A47
  • rheumatoid arthritis antigen A-47,47 kDa heat shock protein
  • Rheumatoid arthritis-related antigen RA-A47
  • serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
  • Serpin H1
  • serpin peptidase inhibitor, clade H (heat shock protein 47), member 1
  • SERPINH1
  • SERPINH2colligin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
AF4937
Species: Hu
Applications: WB, IHC
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-58529
Species: Hu
Applications: ICC/IF
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Hsp47 Antibody (NBP1-88172) (0)

There are no publications for Hsp47 Antibody (NBP1-88172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp47 Antibody (NBP1-88172) (0)

There are no reviews for Hsp47 Antibody (NBP1-88172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hsp47 Antibody (NBP1-88172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hsp47 Products

Bioinformatics Tool for Hsp47 Antibody (NBP1-88172)

Discover related pathways, diseases and genes to Hsp47 Antibody (NBP1-88172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hsp47 Antibody (NBP1-88172)

Discover more about diseases related to Hsp47 Antibody (NBP1-88172).
 

Pathways for Hsp47 Antibody (NBP1-88172)

View related products by pathway.

PTMs for Hsp47 Antibody (NBP1-88172)

Learn more about PTMs related to Hsp47 Antibody (NBP1-88172).
 

Research Areas for Hsp47 Antibody (NBP1-88172)

Find related products by research area.

Blogs on Hsp47

There are no specific blogs for Hsp47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hsp47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINH1
Entrez