HSP10/EPF Antibody (4C11-B11)

Images

 
Western Blot: HSP10/EPF Antibody (4C11-B11) [H00003336-M01] - HSPE1 monoclonal antibody (M01), clone 4C11-B11 Analysis of HSPE1 expression in COLO 320 HSR.
Immunocytochemistry/ Immunofluorescence: HSP10/EPF Antibody (4C11-B11) [H00003336-M01] - Analysis of monoclonal antibody to HSPE1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HSP10/EPF Antibody (4C11-B11) [H00003336-M01] - Analysis of HSPE1 expression in transfected 293T cell line by HSPE1 monoclonal antibody (M01), clone 4C11-B11.Lane 1: HSPE1 transfected lysate(10.9 KDa).Lane ...read more
ELISA: HSP10/EPF Antibody (4C11-B11) [H00003336-M01] - Detection limit for recombinant GST tagged HSPE1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4C11-B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSP10/EPF Antibody (4C11-B11) Summary

Immunogen
HSPE1 (AAH23518, 1 a.a. - 102 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Specificity
HSPE1 - heat shock 10kDa protein 1 (chaperonin 10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSPE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSP10/EPF Antibody (4C11-B11)

  • 10 kDa chaperonin
  • 10 kDa heat shock protein, mitochondrial
  • Chaperonin 10 Homolog
  • Chaperonin 10
  • CPN10HSP10
  • Early-pregnancy factor
  • EPF
  • GroES
  • heat shock 10kD protein 1 (chaperonin 10)
  • heat shock 10kDa protein 1 (chaperonin 10)
  • HSP10
  • HSPE1

Background

This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-24479
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
H00003336-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HSP10/EPF Antibody (H00003336-M01) (0)

There are no publications for HSP10/EPF Antibody (H00003336-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP10/EPF Antibody (H00003336-M01) (0)

There are no reviews for HSP10/EPF Antibody (H00003336-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSP10/EPF Antibody (H00003336-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSP10/EPF Products

Bioinformatics Tool for HSP10/EPF Antibody (H00003336-M01)

Discover related pathways, diseases and genes to HSP10/EPF Antibody (H00003336-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP10/EPF Antibody (H00003336-M01)

Discover more about diseases related to HSP10/EPF Antibody (H00003336-M01).
 

Pathways for HSP10/EPF Antibody (H00003336-M01)

View related products by pathway.

Research Areas for HSP10/EPF Antibody (H00003336-M01)

Find related products by research area.

Blogs on HSP10/EPF

There are no specific blogs for HSP10/EPF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSP10/EPF Antibody (4C11-B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPE1
Entrez
OMIM
Uniprot