HSCB Antibody


Western Blot: HSCB Antibody [NBP1-84066] - Analysis in control (vector only transfected HEK293T lysate) and hSCB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HSCB Antibody [NBP1-84066] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

HSCB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK
Specificity of human HSCB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSCB Protein (NBP1-84066PEP)
Read Publication using
NBP1-84066 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%). Human reactivity reported in scientific literature (PMID: 25012650).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HSCB Antibody

  • DnaJ homolog subfamily C member 20
  • DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20
  • Hsc20
  • HSC20dJ366L4.2
  • HscB iron-sulfur cluster co-chaperone homolog (E. coli)
  • iron-sulfur cluster co-chaperone protein HscB, mitochondrial
  • JAC1
  • J-type co-chaperone HSC20
  • MGC2637
  • MGC74462


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HSCB Antibody (NBP1-84066)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for HSCB Antibody (NBP1-84066) (0)

There are no reviews for HSCB Antibody (NBP1-84066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSCB Antibody (NBP1-84066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HSCB Products

Bioinformatics Tool for HSCB Antibody (NBP1-84066)

Discover related pathways, diseases and genes to HSCB Antibody (NBP1-84066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSCB Antibody (NBP1-84066)

Discover more about diseases related to HSCB Antibody (NBP1-84066).

Pathways for HSCB Antibody (NBP1-84066)

View related products by pathway.

Blogs on HSCB

There are no specific blogs for HSCB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HSCB Antibody and receive a gift card or discount.


Gene Symbol HSCB