HS3ST3A1 Recombinant Protein Antigen

Images

 
There are currently no images for HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HS3ST3A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HS3ST3A1.

Source: E. coli

Amino Acid Sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HS3ST3A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56398.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HS3ST3A1 Recombinant Protein Antigen

  • 3-OST-3A
  • 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase
  • EC 2.8.2
  • EC 2.8.2.30
  • h3-OST-3A
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
  • Heparan sulfate 3-O-sulfotransferase 3A1
  • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1
  • HS3ST3A

Background

HS3ST3A1 codes for a protein with a length of 406 amino acids and a weight of approximately 45 kDa, that is a sulfotransferase that utilizes PAPS to facilitate in the transfer of a sulfo group to a glucosamine on heparan sulfate, which causes the heparan sulfate to become enzyme-modified and acts as a binding receptor to HSV-1 and permits its entry, and is most abundant in the heart and placenta. Current studies are being done on diseases and disorders relating to this gene including recurrent respiratory papillomatosis, herpes simplex, and scoliosis. HS3ST3A1 has also been shown to have interactions with EXT1, EXT2, GLCE, GPC1, and GPC2 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteauc-Lamy syndrome, metabolism, and Hunter syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5968
Species: Hu
Applications: IP, WB
NBP2-16880
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
MAB6085
Species: Hu
Applications: IHC, IP
NBP1-05034
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
7696-GT
Species: Hu
Applications: EnzAct
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-56398PEP
Species: Hu
Applications: AC

Publications for HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP) (0)

There are no publications for HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP) (0)

There are no reviews for HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HS3ST3A1 Products

Research Areas for HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP)

Find related products by research area.

Blogs on HS3ST3A1

There are no specific blogs for HS3ST3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HS3ST3A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HS3ST3A1