HS1BP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HS1BP3 Antibody [NBP1-83690] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: HS1BP3 Antibody [NBP1-83690] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HS1BP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HS1BP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HS1BP3 Protein (NBP1-83690PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HS1BP3 Antibody

  • FLJ14249ETM2
  • HCLS1 binding protein 3
  • HCLS1-binding protein 3
  • HS1-binding protein 3
  • HS1-BP3
  • HSP1BP-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5789
Species: Hu, Mu, Rt
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
AF3086
Species: Hu
Applications: WB, IHC
MAB36791
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu
Applications: WB
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-83690
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HS1BP3 Antibody (NBP1-83690) (0)

There are no publications for HS1BP3 Antibody (NBP1-83690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS1BP3 Antibody (NBP1-83690) (0)

There are no reviews for HS1BP3 Antibody (NBP1-83690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HS1BP3 Antibody (NBP1-83690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HS1BP3 Products

Bioinformatics Tool for HS1BP3 Antibody (NBP1-83690)

Discover related pathways, diseases and genes to HS1BP3 Antibody (NBP1-83690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HS1BP3 Antibody (NBP1-83690)

Discover more about diseases related to HS1BP3 Antibody (NBP1-83690).
 

Pathways for HS1BP3 Antibody (NBP1-83690)

View related products by pathway.

PTMs for HS1BP3 Antibody (NBP1-83690)

Learn more about PTMs related to HS1BP3 Antibody (NBP1-83690).
 

Research Areas for HS1BP3 Antibody (NBP1-83690)

Find related products by research area.

Blogs on HS1BP3

There are no specific blogs for HS1BP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HS1BP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HS1BP3