HPS1 Antibody

Images

 
Immunohistochemistry-Paraffin: HPS1 Antibody [NBP2-31848] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPS1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKKLKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQEIQSTWLEFKAKAFSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HPS1 Protein (NBP2-31848PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPS1 Antibody

  • Hermansky-Pudlak syndrome 1 protein
  • Hermansky-Pudlak syndrome 1
  • Hermansky-Pudlak syndrome type 1
  • Hermansky-Pudlak syndrome
  • HPS
  • MGC5277

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92007
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31848
Species: Hu
Applications: IHC, IHC-P

Publications for HPS1 Antibody (NBP2-31848) (0)

There are no publications for HPS1 Antibody (NBP2-31848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPS1 Antibody (NBP2-31848) (0)

There are no reviews for HPS1 Antibody (NBP2-31848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HPS1 Antibody (NBP2-31848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPS1 Products

HPS1 NBP2-31848

Bioinformatics Tool for HPS1 Antibody (NBP2-31848)

Discover related pathways, diseases and genes to HPS1 Antibody (NBP2-31848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPS1 Antibody (NBP2-31848)

Discover more about diseases related to HPS1 Antibody (NBP2-31848).
 

Pathways for HPS1 Antibody (NBP2-31848)

View related products by pathway.

PTMs for HPS1 Antibody (NBP2-31848)

Learn more about PTMs related to HPS1 Antibody (NBP2-31848).

Blogs on HPS1

There are no specific blogs for HPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPS1
Uniprot