HOXB1 Antibody

Images

 
Immunohistochemistry-Paraffin: HOXB1 Antibody [NBP1-83231] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HOXB1 Protein (NBP1-83231PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXB1 Antibody

  • homeo box 2I
  • homeo box B1
  • homeobox B1
  • Homeobox protein Hox-2I
  • homeobox protein Hox-B1
  • HOX2
  • Hox-2.9
  • HOX2I
  • HOX2IMGC116844
  • HOXB1
  • MGC116843
  • MGC116845

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5014
Species: Hu
Applications: WB, ICC
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
H00003219-D03P
Species: Hu, Mu
Applications: WB
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-83231
Species: Hu
Applications: IHC, IHC-P

Publications for HOXB1 Antibody (NBP1-83231) (0)

There are no publications for HOXB1 Antibody (NBP1-83231).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB1 Antibody (NBP1-83231) (0)

There are no reviews for HOXB1 Antibody (NBP1-83231). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HOXB1 Antibody (NBP1-83231) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB1 Products

Bioinformatics Tool for HOXB1 Antibody (NBP1-83231)

Discover related pathways, diseases and genes to HOXB1 Antibody (NBP1-83231). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB1 Antibody (NBP1-83231)

Discover more about diseases related to HOXB1 Antibody (NBP1-83231).
 

Pathways for HOXB1 Antibody (NBP1-83231)

View related products by pathway.

PTMs for HOXB1 Antibody (NBP1-83231)

Learn more about PTMs related to HOXB1 Antibody (NBP1-83231).

Blogs on HOXB1

There are no specific blogs for HOXB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB1
Entrez