HOXA6 Antibody

Images

 
Western Blot: HOXA6 Antibody [NBP1-83236] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: HOXA6 Antibody [NBP1-83236] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXA6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HOXA6 Protein (NBP1-83236PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXA6 Antibody

  • homeo box A6
  • homeobox A6
  • Homeobox protein Hox-1B
  • homeobox protein HOXA6
  • homeobox protein Hox-A6
  • HOX1
  • HOX1.2
  • HOX1Bhomeo box 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBL1-11673
Species: Hu
NBP2-56537
Species: Hu
Applications: ICC/IF

Publications for HOXA6 Antibody (NBP1-83236) (0)

There are no publications for HOXA6 Antibody (NBP1-83236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA6 Antibody (NBP1-83236) (0)

There are no reviews for HOXA6 Antibody (NBP1-83236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA6 Antibody (NBP1-83236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA6 Products

Bioinformatics Tool for HOXA6 Antibody (NBP1-83236)

Discover related pathways, diseases and genes to HOXA6 Antibody (NBP1-83236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA6 Antibody (NBP1-83236)

Discover more about diseases related to HOXA6 Antibody (NBP1-83236).
 

Pathways for HOXA6 Antibody (NBP1-83236)

View related products by pathway.

PTMs for HOXA6 Antibody (NBP1-83236)

Learn more about PTMs related to HOXA6 Antibody (NBP1-83236).

Blogs on HOXA6

There are no specific blogs for HOXA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA6