HOXA6 Antibody - BSA Free

Immunohistochemistry-Paraffin: HOXA6 Antibody [NBP1-83236] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HOXA6 Antibody [NBP1-83236] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HOXA6 Antibody [NBP1-83236] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HOXA6 Antibody [NBP1-83236] - Staining of human skin shows weak nuclear positivity in squamous epithelial cells.

Analysis in control (vector only transfected HEK293T lysate) and HOXA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOXA6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HOXA6 Antibody - BSA Free (NBP1-83236) is a polyclonal antibody validated for use in IHC and WB. Anti-HOXA6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPV
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXA6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HOXA6 Protein (NBP1-83236PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HOXA6 Antibody - BSA Free

• homeo box A6
• homeobox A6
• Homeobox protein Hox-1B
• homeobox protein HOXA6
• homeobox protein Hox-A6
• HOX1
• HOX1.2
• HOX1Bhomeo box 1B

Background

HOXA6 is 233 amino acids long, weighing approximately 26 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. HOXA4 has also been shown to have interactions with PBX1, PBX3, PKNOX2, POLR2I, and POU2F1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXA6 Antibody (NBP1-83236)(1)

Publication using NBP1-83236

• Arnold A, Imada EL, Zhang ML et al. Differential gene methylation and expression of HOX transcription factor family in orbitofacial neurofibroma Acta Neuropathol Commun 2020-05-04 [PMID: 32366326] (IF/IHC, IHC-P, Human)

Bioinformatics

• Gene Symbol: HOXA6