HOXD3 Antibody (1B12)

Images

 
Western Blot: HOXD3 Antibody (1B12) [H00003232-M09] - Analysis of HOXD3 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: HOXD3 Antibody (1B12) [H00003232-M09] - Analysis of monoclonal antibody to HOXD3 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: HOXD3 Antibody (1B12) [H00003232-M09] - Detection limit for recombinant GST tagged HOXD3 is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXD3 Antibody (1B12) Summary

Immunogen
HOXD3 (NP_008829, 334 a.a. ~ 431 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FEPHPMASNGGGFASANLQGSPVYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCDPHPTYTDLSAHHSSQGRLPEAPKLTH
Specificity
HOXD3 - homeobox D3 (1B12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXD3 Antibody (1B12)

  • homeo box D3
  • homeobox D3
  • Hox-4.1
  • HOX4AMGC10470
  • mouse, homolog of

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in the regulation of cell adhesion processes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003213-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-56195
Species: Hu
Applications: ICC/IF, WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
H00003222-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32356
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
NBP3-16827
Species: Hu, Mu, Rt
Applications: WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-87596
Species: Hu
Applications: IHC, IHC-P, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
H00003228-M01
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
H00003229-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF6318
Species: Hu
Applications: ICC

Publications for HOXD3 Antibody (H00003232-M09) (0)

There are no publications for HOXD3 Antibody (H00003232-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD3 Antibody (H00003232-M09) (0)

There are no reviews for HOXD3 Antibody (H00003232-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXD3 Antibody (H00003232-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXD3 Products

Array H00003232-M09

Bioinformatics Tool for HOXD3 Antibody (H00003232-M09)

Discover related pathways, diseases and genes to HOXD3 Antibody (H00003232-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD3 Antibody (H00003232-M09)

Discover more about diseases related to HOXD3 Antibody (H00003232-M09).
 

Pathways for HOXD3 Antibody (H00003232-M09)

View related products by pathway.

PTMs for HOXD3 Antibody (H00003232-M09)

Learn more about PTMs related to HOXD3 Antibody (H00003232-M09).

Blogs on HOXD3

There are no specific blogs for HOXD3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD3 Antibody (1B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD3
Entrez
Uniprot