HOXC6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOXC6 Antibody [NBP2-54948] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQ
Specificity
Specificity of human HOXC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXC6 Recombinant Protein Antigen (NBP2-54948PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HOXC6 Antibody

  • CP25
  • HHO.C8
  • homeo box 3C
  • homeo box C6
  • homeo box C8 protein
  • homeobox C6
  • Homeobox protein CP25
  • Homeobox protein HHO.C8
  • Homeobox protein Hox-3C
  • homeobox protein Hox-C6
  • HOX3CHOX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003224-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, S-ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-85076
Species: Hu
Applications: WB
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
H00003222-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
H00003204-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
H00003221-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
H00003231-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP3-06103
Species: Hu
Applications: IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-45744
Species: Hu
Applications: WB, IHC
NB120-11899
Species: Mu
Applications: WB, IHC, IHC-Fr
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-42520
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-14098
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXC6 Antibody (NBP2-54948) (0)

There are no publications for HOXC6 Antibody (NBP2-54948).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC6 Antibody (NBP2-54948) (0)

There are no reviews for HOXC6 Antibody (NBP2-54948). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXC6 Antibody (NBP2-54948) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOXC6 Products

Bioinformatics Tool for HOXC6 Antibody (NBP2-54948)

Discover related pathways, diseases and genes to HOXC6 Antibody (NBP2-54948). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC6 Antibody (NBP2-54948)

Discover more about diseases related to HOXC6 Antibody (NBP2-54948).
 

Pathways for HOXC6 Antibody (NBP2-54948)

View related products by pathway.

PTMs for HOXC6 Antibody (NBP2-54948)

Learn more about PTMs related to HOXC6 Antibody (NBP2-54948).

Blogs on HOXC6

There are no specific blogs for HOXC6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC6