HOXA5 Antibody (2C3)

Images

 
Immunocytochemistry/ Immunofluorescence: HOXA5 Antibody (2C3) [H00003202-M04] - Analysis of monoclonal antibody to HOXA5 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: HOXA5 Antibody (2C3) [H00003202-M04] - Detection limit for recombinant GST tagged HOXA5 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXA5 Antibody (2C3) Summary

Immunogen
HOXA5 (NP_061975.1 171 a.a. - 270 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
Specificity
HOXA5 (2C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXA5 Antibody (2C3)

  • homeo box 1C
  • homeo box A5
  • homeobox A5
  • Homeobox protein Hox-1C
  • homeobox protein HOXA5
  • homeobox protein Hox-A5
  • HOX1
  • HOX1.3
  • HOX1CMGC9376

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBL1-11664
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBL1-11673
Species: Hu
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP1-83236
Species: Hu
Applications: WB, IHC, IHC-P
AF6318
Species: Hu
Applications: ICC
AF2400
Species: Hu
Applications: WB, ChIP, ICC
24420002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-56537
Species: Hu
Applications: ICC/IF

Publications for HOXA5 Antibody (H00003202-M04) (0)

There are no publications for HOXA5 Antibody (H00003202-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA5 Antibody (H00003202-M04) (0)

There are no reviews for HOXA5 Antibody (H00003202-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXA5 Antibody (H00003202-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA5 Products

Bioinformatics Tool for HOXA5 Antibody (H00003202-M04)

Discover related pathways, diseases and genes to HOXA5 Antibody (H00003202-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA5 Antibody (H00003202-M04)

Discover more about diseases related to HOXA5 Antibody (H00003202-M04).
 

Pathways for HOXA5 Antibody (H00003202-M04)

View related products by pathway.

PTMs for HOXA5 Antibody (H00003202-M04)

Learn more about PTMs related to HOXA5 Antibody (H00003202-M04).
 

Research Areas for HOXA5 Antibody (H00003202-M04)

Find related products by research area.

Blogs on HOXA5

There are no specific blogs for HOXA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA5 Antibody (2C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA5
Entrez
OMIM
Uniprot