Recombinant Human Host Cell Factor 1/HCFC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Host Cell Factor 1/HCFC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-87 of Human HCFC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTIL

Protein/Peptide Type
Partial Recombinant Protein
Gene
HCFC1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Host Cell Factor 1/HCFC1 Protein

  • C1 Factor
  • CFF
  • CFFC1 factor
  • HCF
  • HCF1
  • HCF1HFC1
  • HCF-1VP16 accessory protein
  • HCFC1
  • HFC1
  • host cell factor C1 (VP16-accessory protein)
  • MGC70925
  • VCAFhost cell factor 1

Background

This gene is a member of the host cell factor family and encodes a protein with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in control of the cell cycle and transcriptional regulation during herpes simplex virus infection. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-45733
Species: Hu
Applications: WB, IHC, IF
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-1015
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
H00003054-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01) (0)

There are no publications for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01) (0)

There are no reviews for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Host Cell Factor 1/HCFC1 Products

Bioinformatics Tool for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01)

Discover related pathways, diseases and genes to Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01)

Discover more about diseases related to Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01).
 

Pathways for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01)

View related products by pathway.

PTMs for Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01)

Learn more about PTMs related to Host Cell Factor 1/HCFC1 Partial Recombinant Protein (H00003054-Q01).

Blogs on Host Cell Factor 1/HCFC1

There are no specific blogs for Host Cell Factor 1/HCFC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Host Cell Factor 1/HCFC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HCFC1
Entrez