HOP Recombinant Protein Antigen

Images

 
There are currently no images for HOP Protein (NBP1-92003PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HOP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOPX.

Source: E. coli

Amino Acid Sequence: MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HOPX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92003.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOP Recombinant Protein Antigen

  • CAMEO
  • HOD
  • homeodomain-only protein
  • HOP homeobox
  • HOPLAGYNECC1OB1SMAP31
  • Lung cancer-associated Y protein
  • MGC20820
  • not expressed in choriocarcinoma clone 1
  • Not expressed in choriocarcinoma protein 1
  • odd homeobox 1 protein
  • Odd homeobox protein 1
  • TOTO

Background

HOP, also known as Homeodomain-only protein, has a 73 amino acid short isoform that is 8 kDa and a long 94 amino acid isoform that is 10 kDa; nucleus located; widely expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen; may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development; prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF; overexpression causes cardiac hypertrophy; and may also act as a tumor suppressor. Disease research is currently being studied with relation to choriocarcinoma, abdominal actinomycosis, nevus of ota, actinomycosis, lung cancer, nevus, carcinoma, squamous cell carcinoma, oral squamous cell carcinoma, esophageal squamous cell carcinoma, dilated cardiomyopathy, thyroid carcinoma, endometrial cancer, cardiomyopathy, gastric cancer, glioblastoma, esophagitis, and thyroiditis. This protein has shown an interaction with HDAC2, EPC1, SRF, GZMB, HOXB9, TLX3, and ZSCAN1 in the negative regulation of transcription from RNA polymerase II promoter, trophectodermal cell differentiation, transcription, DNA-dependent, regulation of transcription, DNA-dependent, and multicellular organismal development pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90267
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00007178-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC,  IHC-P, KD, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF6380
Species: Mu
Applications: WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB110-96874
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
AF5065
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for HOP Protein (NBP1-92003PEP) (0)

There are no publications for HOP Protein (NBP1-92003PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOP Protein (NBP1-92003PEP) (0)

There are no reviews for HOP Protein (NBP1-92003PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HOP Protein (NBP1-92003PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOP Products

Research Areas for HOP Protein (NBP1-92003PEP)

Find related products by research area.

Blogs on HOP

There are no specific blogs for HOP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HOP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HOPX