HOOK2 Antibody - BSA Free

Western Blot: HOOK2 Antibody [NBP2-47430] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Immunohistochemistry: HOOK2 Antibody [NBP2-47430] - Staining of human duodenum shows strong luminal membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOOK2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AIQELMTKDTPDSLSPETYGNFDSQSRRYYFLSEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKKLLLLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOOK2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HOOK2 Protein (NBP2-47430PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HOOK2 Antibody - BSA Free

• FLJ26218
• hHK2
• HK2h-hook2
• hook homolog 2 (Drosophila)
• protein Hook homolog 2

Background

HOOK2 is 719 amino acids long, weighing 83 kDa, with a shorter isoform that is 717 amino acids long, also weighing approximately 83 kDa. HOOK2 is a hook protein, which functions as a component of the FTS/Hook/FHIP complex, which promotes vesicle function. HOOK2 also works to establish and maintain centrosome function and can work to help position and for aggresomes. HOOK2 has also been shown to have interactions with ABLIM1, AKTIP, APEX2, EPS8, and FAM107A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOOK2