HOOK2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LEPPTDSSTARRIEELQHNLQKKDADLRAMEERYRRYVDKARMVMQTMEPKQRPAAGAPPELHSLRTQLRERDVRIRHLEMDFEKSRSQREQEEKLLIS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HOOK2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HOOK2 Antibody - BSA Free
Background
HOOK2 is 719 amino acids long, weighing 83 kDa, with a shorter isoform that is 717 amino acids long, also weighing approximately 83 kDa. HOOK2 is a hook protein, which functions as a component of the FTS/Hook/FHIP complex, which promotes vesicle function. HOOK2 also works to establish and maintain centrosome function and can work to help position and for aggresomes. HOOK2 has also been shown to have interactions with ABLIM1, AKTIP, APEX2, EPS8, and FAM107A.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu, Po, Rt
Applications: IHC, IHC-P, WB
Publications for HOOK2 Antibody (NBP2-47429) (0)
There are no publications for HOOK2 Antibody (NBP2-47429).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOOK2 Antibody (NBP2-47429) (0)
There are no reviews for HOOK2 Antibody (NBP2-47429).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HOOK2 Antibody (NBP2-47429) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOOK2 Products
Blogs on HOOK2