HNRPLL Antibody - BSA Free

Western Blot: HNRPLL Antibody [NBP2-85055] - Host: Rabbit. Target Name: HNRPLL. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HNRPLL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HNRPLL Antibody - BSA Free (NBP2-85055) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPLL. Peptide sequence: AQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPLL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HNRPLL Antibody - BSA Free

• heterogeneous nuclear ribonucleoprotein L-like
• hnRNPLL
• SRRF
• stromal RNA regulating factor
• Stromal RNA-regulating factor

Background

HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicingof CD45 (PTPRC; MIM 151460), a tyrosine phosphatase essential for T-cell development and activation (Oberdoerffer etal., 2008 (PubMed 18669861)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPLL