HNRPDL Antibody

Western Blot: HNRPDL Antibody [NBP1-57156] - Titration: 1.0ug/ml Positive Control: Daudi cell lysate.

Immunohistochemistry: HNRPDL Antibody [NBP1-57156] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.

Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

• Reactivity: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Ze
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HNRPDL Antibody Summary

• Immunogen: Synthetic peptides corresponding to HNRPDL (heterogeneous nuclear ribonucleoprotein D-like) The peptide sequence was selected from the middle region of HNRPDL. Peptide sequence TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRPDL
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
• Application Notes: This is a rabbit polyclonal antibody against HNRPDL and was validated on Western Blot and immunohistochemistry-p
• Control:

  TOR3A Knockout HeLa Cell Lysate
  HNRPDL Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HNRPDL Antibody

• A+U-rich element RNA binding factor
• AU-rich element RNA-binding factor
• heterogeneous nuclear ribonucleoprotein D-like
• hnRNP DL
• hnRNP D-like
• HNRNP
• JKTBP2
• JKTBPJKT41-binding protein
• laAUF1
• Protein laAUF1

Background

HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRPDL