HNRPDL Antibody Summary
Immunogen |
Synthetic peptides corresponding to HNRPDL (heterogeneous nuclear ribonucleoprotein D-like) The peptide sequence was selected from the middle region of HNRPDL.
Peptide sequence TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species |
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HNRPDL |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
Application Notes |
This is a rabbit polyclonal antibody against HNRPDL and was validated on Western Blot and immunohistochemistry-p |
Control |
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HNRPDL Antibody
Background
HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr, KD
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Publications for HNRPDL Antibody (NBP1-57156) (0)
There are no publications for HNRPDL Antibody (NBP1-57156).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HNRPDL Antibody (NBP1-57156) (0)
There are no reviews for HNRPDL Antibody (NBP1-57156).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HNRPDL Antibody (NBP1-57156) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional HNRPDL Products
Bioinformatics Tool for HNRPDL Antibody (NBP1-57156)
Discover related pathways, diseases and genes to HNRPDL Antibody (NBP1-57156). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HNRPDL Antibody (NBP1-57156)
Discover more about diseases related to HNRPDL Antibody (NBP1-57156).
| | Pathways for HNRPDL Antibody (NBP1-57156)
View related products by pathway.
|
Blogs on HNRPDL