HNRNPA0 Antibody


Western Blot: HNRNPA0 Antibody [NBP1-83240] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HNRNPA0 Antibody [NBP1-83240] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining in human cerebral cortex and pancreas tissues using anti-HNRNPA0 antibody. Corresponding HNRNPA0 RNA-seq data are presented for the same tissues.
Western Blot: HNRNPA0 Antibody [NBP1-83240] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HNRNPA0 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
Specificity of human, mouse, rat HNRNPA0 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
HNRNPA0 Lysate (NBP2-65663)
Control Peptide
HNRNPA0 Protein (NBP1-83240PEP)
Read Publication using
NBP1-83240 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat, Mouse reactivity reported in scientific literature (PMID: 25257914).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HNRNPA0 Antibody

  • heterogeneous nuclear ribonucleoprotein A0
  • hnRNA binding protein
  • hnRNPA0
  • HNRPA0hnRNP A0


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Am, Bv, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HNRNPA0 Antibody (NBP1-83240)(1)

We have publications tested in 2 confirmed species: Mouse, Rat.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for HNRNPA0 Antibody (NBP1-83240) (0)

There are no reviews for HNRNPA0 Antibody (NBP1-83240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HNRNPA0 Antibody (NBP1-83240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for HNRNPA0 Antibody (NBP1-83240)

Discover related pathways, diseases and genes to HNRNPA0 Antibody (NBP1-83240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNRNPA0 Antibody (NBP1-83240)

Discover more about diseases related to HNRNPA0 Antibody (NBP1-83240).

Pathways for HNRNPA0 Antibody (NBP1-83240)

View related products by pathway.

PTMs for HNRNPA0 Antibody (NBP1-83240)

Learn more about PTMs related to HNRNPA0 Antibody (NBP1-83240).

Blogs on HNRNPA0

There are no specific blogs for HNRNPA0, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HNRNPA0 Antibody and receive a gift card or discount.


Gene Symbol HNRNPA0