HNRNPA0 Antibody

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human cerebral cortex, endometrium, liver and lower gastrointestinal using Anti-HNRNPA0 antibody NBP1-83240 (A) shows similar protein distribution across tissues to independent antibody NBP2-55847 (B).

Western Blot: HNRNPA0 Antibody [NBP1-83240] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: HNRNPA0 Antibody [NBP1-83240] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-83240] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HNRNPA0 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPA0
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat, Mouse reactivity reported in scientific literature (PMID: 25257914).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HNRNPA0 Antibody

• heterogeneous nuclear ribonucleoprotein A0
• hnRNA binding protein
• hnRNPA0
• HNRPA0hnRNP A0

Background

HNRNPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HNRNPA0 Antibody (NBP1-83240)(1)

Publication using NBP1-83240

• Xu L, Yates CC, Lockyer P et al. MMI-0100 inhibits cardiac fibrosis in myocardial infarction by direct actions on cardiomyocytes and fibroblasts via MK2 inhibition. J Mol Cell Cardiol 2014-12-01 [PMID: 25257914] (WB, Rat, Mouse)

Bioinformatics

• Gene Symbol: HNRNPA0