HNRNPA0 Antibody - BSA Free

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Amount and Lane 1 : 5% Input Lane 2: 5% Sup Lane 3: Normal IgG Lane 4: hn-RNPA0 ppt. k562 Sample IP Antibody: HNRPA0 Amount of IP Antibody: Primary Antibody: HNRPA0 Primary Antibody Dilution: 1 : 4000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody

Immunocytochemistry/Immunofluorescence: HNRNPA0 Antibody [NBP1-57275] - MCF7 cells Primary Antibody Dilution : 1:200 Secondary Antibody: Anti-rabbit-FITC Secondary Antibody Dilution: 1:500 Color/Signal Descriptions: DAPI: Blue hn-RNPA0: Green Gene Name: HNRPA0

Immunohistochemistry: HNRNPA0 Antibody [NBP1-57275] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Jurkat cell lysate, Antibody Titration: 0.625ug/ml

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Lanes: Lane 1 : 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate Primary, Antibody Dilution: 1 : 4000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: HNRPA0.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

HNRNPA0 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HNRPA0 (heterogeneous nuclear ribonucleoprotein A0) The peptide sequence was selected from the middle region of HNRPA0. Peptide sequence KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPA0
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for HNRNPA0 Antibody - BSA Free

• heterogeneous nuclear ribonucleoprotein A0
• hnRNA binding protein
• hnRNPA0
• HNRPA0hnRNP A0

Background

HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPA0
• Uniprot:
  • Q13151(Human)