hnRNP G Antibody

Images

 
Western Blot: hnRNP G Antibody [NBP1-79904] - Hela, Antibody Dilution: 1.0 ug/ml RBMX is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: hnRNP G Antibody [NBP1-79904] - Titration: 1.0 ug/ml Positive Control: OVCAR-3 Whole Cell.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP G Antibody Summary

Immunogen
The specific Immunogen is proprietary information. Peptide sequence SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBMX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RBMX and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for hnRNP G Antibody

  • Glycoprotein p43
  • heterogeneous nuclear ribonucleoprotein G
  • hnRNP G
  • hnRNP-G
  • HNRPG
  • RBMXP1
  • RBMXRT
  • RNA binding motif protein, X chromosome
  • RNA binding motif protein, X-linked
  • RNA-binding motif protein, X chromosome
  • RNMX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57363
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
H00027288-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-76892
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ICC
H00010772-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81580
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB2334
Species: Hu, Mu
Applications: WB, Simple Western
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-84951
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for hnRNP G Antibody (NBP1-79904) (0)

There are no publications for hnRNP G Antibody (NBP1-79904).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP G Antibody (NBP1-79904) (0)

There are no reviews for hnRNP G Antibody (NBP1-79904). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hnRNP G Antibody (NBP1-79904) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional hnRNP G Products

Bioinformatics Tool for hnRNP G Antibody (NBP1-79904)

Discover related pathways, diseases and genes to hnRNP G Antibody (NBP1-79904). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP G Antibody (NBP1-79904)

Discover more about diseases related to hnRNP G Antibody (NBP1-79904).
 

Pathways for hnRNP G Antibody (NBP1-79904)

View related products by pathway.

PTMs for hnRNP G Antibody (NBP1-79904)

Learn more about PTMs related to hnRNP G Antibody (NBP1-79904).

Blogs on hnRNP G

There are no specific blogs for hnRNP G, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBMX
Uniprot