hnRNP A2B1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPA2B1. Source: E. coli
Amino Acid Sequence: VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HNRNPA2B1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89675. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for hnRNP A2B1 Recombinant Protein Antigen
Background
RNA polymerase II transcripts in the nucleus are in complex with several different proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins act in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA ranslation, and turnover.2. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts. Isolated hnRNPs consist of protein groups named A to U and many of these protein groups consist of more than one isoform.3 The major steadystate proteins of the isolated hnRNP complex are the A1, A2, B1, B2, C1, and C2 with a range of molecular weights (34-43 kDa).3 hnRNP-A2/B1 proteins are located in the nucleus of most tissues cells; however, the hnRNP-A2 protein is found also in the cytoplasm of skin and esophagus cells. In rat brain, hnRNP-A2/B1 proteins are found in neurons in the cerebral cortices, hippocampal formation, olfactory regions, caudate-putamin, and the supraoptic ucleus of the hypothalamus.4 Expression of hnRNP-A2/B1 proteins was found also in lung development and its over expression correlated with lung cancer.5
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: AC
Publications for hnRNP A2B1 Protein (NBP1-89675PEP) (0)
There are no publications for hnRNP A2B1 Protein (NBP1-89675PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for hnRNP A2B1 Protein (NBP1-89675PEP) (0)
There are no reviews for hnRNP A2B1 Protein (NBP1-89675PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for hnRNP A2B1 Protein (NBP1-89675PEP) (0)
Additional hnRNP A2B1 Products
Research Areas for hnRNP A2B1 Protein (NBP1-89675PEP)
Find related products by research area.
|
Blogs on hnRNP A2B1