hnRNP A2B1 Recombinant Protein Antigen

Images

 
There are currently no images for hnRNP A2B1 Protein (NBP1-89675PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

hnRNP A2B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPA2B1.

Source: E.coli

Amino Acid Sequence: VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNRNPA2B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89675.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for hnRNP A2B1 Recombinant Protein Antigen

  • DKFZp779B0244
  • FLJ22720
  • heterogeneous nuclear ribonucleoprotein A2/B1
  • heterogeneous nuclear ribonucleoprotein B1
  • heterogeneous nuclear ribonucleoproteins A2/B1
  • hnRNP A2 / hnRNP B1
  • HNRNPA2
  • HNRNPB1
  • HNRPA2
  • HNRPA2B1hnRNP A2/B1
  • HNRPB1
  • nuclear ribonucleoprotein particle A2 protein
  • RNPA2
  • SNRPB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-672
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92962
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP1-89675PEP
Species: Hu
Applications: AC

Publications for hnRNP A2B1 Protein (NBP1-89675PEP) (0)

There are no publications for hnRNP A2B1 Protein (NBP1-89675PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP A2B1 Protein (NBP1-89675PEP) (0)

There are no reviews for hnRNP A2B1 Protein (NBP1-89675PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for hnRNP A2B1 Protein (NBP1-89675PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hnRNP A2B1 Products

Bioinformatics Tool for hnRNP A2B1 Protein (NBP1-89675PEP)

Discover related pathways, diseases and genes to hnRNP A2B1 Protein (NBP1-89675PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP A2B1 Protein (NBP1-89675PEP)

Discover more about diseases related to hnRNP A2B1 Protein (NBP1-89675PEP).
 

Pathways for hnRNP A2B1 Protein (NBP1-89675PEP)

View related products by pathway.

PTMs for hnRNP A2B1 Protein (NBP1-89675PEP)

Learn more about PTMs related to hnRNP A2B1 Protein (NBP1-89675PEP).
 

Research Areas for hnRNP A2B1 Protein (NBP1-89675PEP)

Find related products by research area.

Blogs on hnRNP A2B1

There are no specific blogs for hnRNP A2B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our hnRNP A2B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPA2B1