Recombinant Human HNF-3 beta/FoxA2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HNF-3 beta/FoxA2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 363-457 of Human HNF-3 beta/FoxA2

Source: Wheat Germ

Amino Acid Sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HNF-3 beta/FoxA2 Protein

  • forkhead box A2
  • Forkhead box protein A2
  • FoxA2
  • hepatic nuclear factor-3-beta
  • hepatocyte nuclear factor 3, beta
  • hepatocyte nuclear factor 3-beta
  • HNF3 beta
  • HNF-3 beta
  • HNF-3B
  • HNF-3-beta
  • HNF3BTCF-3B
  • MGC19807
  • TCF3B
  • Transcription factor 3B

Background

FOXA2 - forkhead box A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55686
Species: Hu
Applications: ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-38243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF4186
Species: Hu
Applications: WB, ICC
NBP1-84079
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00003170-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01) (0)

There are no publications for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01) (0)

There are no reviews for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HNF-3 beta/FoxA2 Products

Bioinformatics Tool for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01)

Discover related pathways, diseases and genes to HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01)

Discover more about diseases related to HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01).
 

Pathways for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01)

View related products by pathway.

PTMs for HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01)

Learn more about PTMs related to HNF-3 beta/FoxA2 Partial Recombinant Protein (H00003170-Q01).

Blogs on HNF-3 beta/FoxA2

There are no specific blogs for HNF-3 beta/FoxA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HNF-3 beta/FoxA2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXA2
Entrez