HNF-3 beta/FoxA2 Antibody (1C7) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
| Specificity |
FOXA2 - forkhead box A2 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
FOXA2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Immunoprecipitation
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for HNF-3 beta/FoxA2 Antibody (1C7) - Azide and BSA Free
Background
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: ChIP, ICC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IP
Publications for HNF-3 beta/FoxA2 Antibody (H00003170-M10)(5)
Showing Publications 1 -
5 of 5.
| Publications using H00003170-M10 |
Applications |
Species |
| Yu Y, Alonzo M, Ye S et al. Generation of an induced pluripotent stem cell line (NCHi010-A) from a 6-year-old female with Down syndrome and without congenital heart disease Stem Cell Research 2023-09-01 [PMID: 37392705] |
|
|
| S Adhicary, S Ye, H Lin, K Texter, V Garg, MT Zhao Establishment of NCHi009-A, an iPSC line from a patient with hypoplastic left heart syndrome (HLHS) carrying a heterozygous NOTCH1 mutation Stem Cell Research, 2022-12-31;66(0):103013. 2022-12-31 [PMID: 36599283] |
|
|
| M Alonzo, J Contreras, S Ye, H Lin, L Hernandez-, KL McBride, K Texter, V Garg, MT Zhao Characterization of an iPSC line NCHi006-A from a patient with hypoplastic left heart syndrome (HLHS) Stem Cell Research, 2022-08-09;64(0):102892. 2022-08-09 [PMID: 35987121] |
|
|
| J Contreras, M Alonzo, S Ye, H Lin, L Hernandez-, KL McBride, K Texter, V Garg, MT Zhao Generation of an induced pluripotent stem cell line NCHi003-A from a 11-year-old male with pulmonary atresia with intact ventricular septum (PA-IVS) Stem Cell Research, 2022-08-10;64(0):102893. 2022-08-10 [PMID: 35987120] |
|
|
| J Kim, J Jeon, B Song, N Lee, S Ko, Y Cha, P Leblanc, H Seo, KS Kim Spotting-based differentiation of functional dopaminergic progenitors from human pluripotent stem cells Nature Protocols, 2022-02-09;0(0):. 2022-02-09 [PMID: 35140411] |
|
|
Reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M10) (0)
There are no reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M10).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HNF-3 beta/FoxA2 Antibody (H00003170-M10) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HNF-3 beta/FoxA2 Products
Blogs on HNF-3 beta/FoxA2