HMGN2 Antibody - BSA Free

Western Blot: HMGN2 Antibody [NBP3-04809] - Analysis of extracts of various cell lines, using HMGN2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Product Discontinued

HMGN2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human HMGN2 (NP_005508.1). MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HMGN2 Antibody - BSA Free

• High mobility group nucleosome-binding domain-containing protein 2
• high-mobility group (nonhistone chromosomal) protein 17
• high-mobility group nucleosomal binding domain 2
• HMG17high mobility group protein N2
• MGC5629
• MGC88718
• non-histone chromosomal protein HMG-17
• nonhistone chromosomal protein HMG-17

Background

HMG17 (high mobility group transcription factor 17) is an 18 kD high mobility group chromosomal protein. This nuclear protein is common to all eukaryotes and is developmentally regulated. HMG17 binds DNA in a non-sequence specific manner and interacts with nucleosomes to modulate chromatin structure. HMG17 regulates the gene expression of p53, Hox transcription factors, and steroid hormone receptors (increases DNA binding affinity). Phosphorylation of HMG17 may interfere with nuclear localization and favor release from nuclei. HMG17 is upregulated by wild-type p53 and increases during embryogenesis and is downregulated during differentiation and development. This protein is modified by phosphorylation and acetylation. HMG17 interacts with nucleosomes and probably forms multi-unit complexes with unrelated proteins. The Poly6081 antibody recognizes human and mouse HMG17 and has been shown to be useful for Western blotting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGN2