HLRC1 Antibody - BSA Free

Western Blot: HLRC1 Antibody [NBP2-85050] - WB Suggested Anti-DOHH Antibody. Titration: 1.0 ug/ml. Positive Control: MDA-MB-435S Whole CellDOHH is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HLRC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HLRC1 Antibody - BSA Free (NBP2-85050) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of HLRC1. Peptide sequence: GQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DOHH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HLRC1 Antibody - BSA Free

• Deoxyhypusine dioxygenase
• deoxyhypusine hydroxylase
• deoxyhypusine hydroxylase/monooxygenase
• Deoxyhypusine monooxygenase
• EC 1.14.99.29
• hDOHH
• HEAT-like (PBS lyase) repeat containing 1
• HEAT-like repeat-containing protein 1
• HLRC1
• MGC4293

Background

Deoxyhypusine hydroxylase (DOHH; EC 1.14.99.29) catalyzes the final step in the formation of the amino acid hypusine in eukaryotic initiation factor-5A (EIF5A; see MIM 600187).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DOHH