HLA DQB2 Antibody

Images

 
Western Blot: HLA DQB2 Antibody [H00003120-B01P] - Analysis of HLA-DQB2 expression in transfected 293T cell line by HLA-DQB2 polyclonal antibody. Lane 1: HLA-DQB2 transfected lysate(26.50 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLA DQB2 Antibody Summary

Immunogen
HLA-DQB2 (NP_872355.1, 1 a.a. - 231 a.a.) full-length human protein. MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HLA-DQB2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DQB2 Antibody

  • class II, DQ beta 1
  • DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB))
  • HLA-DQB1
  • major histocompatibility complex, class II, DQ beta 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for HLA DQB2 Antibody (H00003120-B01P) (0)

There are no publications for HLA DQB2 Antibody (H00003120-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQB2 Antibody (H00003120-B01P) (0)

There are no reviews for HLA DQB2 Antibody (H00003120-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQB2 Antibody (H00003120-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DQB2 Products

Bioinformatics Tool for HLA DQB2 Antibody (H00003120-B01P)

Discover related pathways, diseases and genes to HLA DQB2 Antibody (H00003120-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DQB2 Antibody (H00003120-B01P)

Discover more about diseases related to HLA DQB2 Antibody (H00003120-B01P).
 

Pathways for HLA DQB2 Antibody (H00003120-B01P)

View related products by pathway.

Blogs on HLA DQB2

There are no specific blogs for HLA DQB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DQB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQB2