Histone Deacetylase 8/HDAC8 Antibody - BSA Free

Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Analysis in human thyroid gland and skeletal muscle tissues. Corresponding HDAC8 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human cell line PC-3 shows localization to nucleus & plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human rectum shows moderate to strong nuclear positivity in glandular cells, as well as in lymphoid cells.

Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human skeletal muscle shows no positivity in myocytes.

Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Histone Deacetylase 8/HDAC8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEF
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HDAC8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Histone Deacetylase 8/HDAC8 Protein (NBP2-14085PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Histone Deacetylase 8/HDAC8 Antibody - BSA Free

• EC 3.5.1.98
• HD8
• HDAC8
• HDACL1
• Histone Deacetylase 8
• histone deacetylase-like 1
• RPD3

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085)(1)

Publication using NBP2-14085

• Emmons, MF;Faiao-Flores, F;Sharma, R;Thapa, R;Messina, JL;Becker, JC;Schadendorf, D;Seto, E;Sondak, VK;Koomen, JM;Chen, YA;Lau, EK;Wan, L;Licht, JD;Smalley, KSM; HDAC8 regulates a stress response pathway in melanoma to mediate escape from BRAF inhibitor therapy Cancer Res. 2019-04-15 [PMID: 30987999] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: HDAC8