Histone Deacetylase 8/HDAC8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & plasma membrane. Antibody staining is shown ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Analysis in human thyroid gland and skeletal muscle tissues. Corresponding HDAC8 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody [NBP2-14085] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Histone Deacetylase 8/HDAC8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQL ATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEF
Specificity
Specificity of human Histone Deacetylase 8/HDAC8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Histone Deacetylase 8/HDAC8 Protein (NBP2-14085PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Histone Deacetylase 8/HDAC8 Antibody

  • EC 3.5.1.98
  • HD8
  • HDAC8
  • HDACL1
  • Histone Deacetylase 8
  • histone deacetylase-like 1
  • RPD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
MAB7940
Species: Hu
Applications: WB, IHC
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
H00008294-P01
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085) (0)

There are no publications for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085) (0)

There are no reviews for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085)

Discover related pathways, diseases and genes to Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085)

Discover more about diseases related to Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085).
 

Pathways for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085)

View related products by pathway.

PTMs for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085)

Learn more about PTMs related to Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085).
 

Research Areas for Histone Deacetylase 8/HDAC8 Antibody (NBP2-14085)

Find related products by research area.

Blogs on Histone Deacetylase 8/HDAC8

There are no specific blogs for Histone Deacetylase 8/HDAC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone Deacetylase 8/HDAC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC8
Entrez