Histidase Antibody


Western Blot: Histidase Antibody [NBP1-53135] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-53135] - Human Fetal Heart Tissue. Antibody concentration of 1.25 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Histidase Antibody Summary

Synthetic peptides corresponding to HAL(histidine ammonia-lyase) The peptide sequence was selected from the N terminal of HAL. Peptide sequence INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HAL and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Histidase Antibody

  • EC 4.3.1
  • EC
  • HIS
  • histidase
  • histidine ammonia-lyase
  • HSTD


HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Histidase Antibody (NBP1-53135) (0)

There are no publications for Histidase Antibody (NBP1-53135).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histidase Antibody (NBP1-53135) (0)

There are no reviews for Histidase Antibody (NBP1-53135). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histidase Antibody (NBP1-53135) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Histidase Products

Bioinformatics Tool for Histidase Antibody (NBP1-53135)

Discover related pathways, diseases and genes to Histidase Antibody (NBP1-53135). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histidase Antibody (NBP1-53135)

Discover more about diseases related to Histidase Antibody (NBP1-53135).

Pathways for Histidase Antibody (NBP1-53135)

View related products by pathway.

PTMs for Histidase Antibody (NBP1-53135)

Learn more about PTMs related to Histidase Antibody (NBP1-53135).

Blogs on Histidase

There are no specific blogs for Histidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Histidase Antibody and receive a gift card or discount.


Gene Symbol HAL