Histatin 1 Antibody

Images

 
Western Blot: Histatin 1 Antibody [H00003346-B01P] - Analysis of HTN1 expression in transfected 293T cell line by HTN1 polyclonal antibody. Lane 1: HTN1 transfected lysate(6.27 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Histatin 1 Antibody Summary

Immunogen
HTN1 (NP_002150.1, 1 a.a. - 57 a.a.) full-length human protein. MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Specificity
HTN1 - histatin 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HTN1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histatin 1 Antibody

  • HIS1Histidine-rich protein 1
  • histatin 1
  • histatin-1
  • Post-PB protein
  • PPB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NLS836
Species: Hu, Mk, Pm
Applications: IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
19650002
Species: Hu
Applications: ELISA, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
AF4036
Species: Hu
Applications: WB, Simple Western
H00010879-T01
Species: Hu
NBP2-48988
Species: Hu
Applications: IHC
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC

Publications for Histatin 1 Antibody (H00003346-B01P) (0)

There are no publications for Histatin 1 Antibody (H00003346-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histatin 1 Antibody (H00003346-B01P) (0)

There are no reviews for Histatin 1 Antibody (H00003346-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histatin 1 Antibody (H00003346-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histatin 1 Products

Histatin 1 H00003346-B01P

Bioinformatics Tool for Histatin 1 Antibody (H00003346-B01P)

Discover related pathways, diseases and genes to Histatin 1 Antibody (H00003346-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histatin 1 Antibody (H00003346-B01P)

Discover more about diseases related to Histatin 1 Antibody (H00003346-B01P).
 

Pathways for Histatin 1 Antibody (H00003346-B01P)

View related products by pathway.

PTMs for Histatin 1 Antibody (H00003346-B01P)

Learn more about PTMs related to Histatin 1 Antibody (H00003346-B01P).

Blogs on Histatin 1

There are no specific blogs for Histatin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histatin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTN1
Entrez
Uniprot