Histatin 1 Antibody - Azide and BSA Free

Western Blot: Histatin 1 Antibody [H00003346-B01P] - Analysis of HTN1 expression in transfected 293T cell line by HTN1 polyclonal antibody. Lane 1: HTN1 transfected lysate(6.27 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Histatin 1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HTN1 (NP_002150.1, 1 a.a. - 57 a.a.) full-length human protein. MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
• Specificity: HTN1 - histatin 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HTN1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histatin 1 Antibody - Azide and BSA Free

• HIS1Histidine-rich protein 1
• histatin 1
• histatin-1
• Post-PB protein
• PPB

Background

FUNCTION: Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities.; Tissue specificity: Submandibular and parotid glands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTN1
• Entrez:
  • 3346(Human)
• Uniprot:
  • NP_002150.1(Human)