Histamine N-Methyltransferase/HNMT Antibody


Western Blot: HNMT Antibody [NBP1-69134] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Histamine N-Methyltransferase/HNMT Antibody Summary

Synthetic peptides corresponding to HNMT (histamine N-methyltransferase) The peptide sequence was selected from the N terminal of HNMT. Peptide sequence PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HNMT and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Histamine N-Methyltransferase/HNMT Antibody

  • EC
  • Histamine NMethyltransferase
  • Histamine N-Methyltransferase
  • HMT
  • HNMT
  • HNMT-S1
  • HNMT-S2


In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB

Publications for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134) (0)

There are no publications for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134) (0)

There are no reviews for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Histamine N-Methyltransferase/HNMT Products

Bioinformatics Tool for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134)

Discover related pathways, diseases and genes to Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134)

Discover more about diseases related to Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134).

Pathways for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134)

View related products by pathway.

PTMs for Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134)

Learn more about PTMs related to Histamine N-Methyltransferase/HNMT Antibody (NBP1-69134).

Blogs on Histamine N-Methyltransferase/HNMT

There are no specific blogs for Histamine N-Methyltransferase/HNMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Histamine N-Methyltransferase/HNMT Antibody and receive a gift card or discount.


Gene Symbol HNMT