Histamine H3R Antibody (7H8E6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histamine H3R (Q9Y5N1). MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFVADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRW |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
HRH3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL
- Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Histamine H3R Antibody (7H8E6)
Background
H3 Histamine Receptor regulates the release of the neurotransmitters norepinephrine and somatostatin. In histamine-containing neurons of the brain, the H3 receptor acts as a presynaptic autoreceptor, while in nonhistamine-containing neurons in both the central and peripheral nervous systems, it acts as a presynaptic heteroreceptor. Multiple isoforms of H3 receptors are produced by alternative splicing. Histamine H3 receptor has been reported primarily in brain. ESTs have been isolated from brain (normal and cancer), breast cancer, colon cancer, and retinoblastoma libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Publications for Histamine H3R Antibody (NBP3-16202) (0)
There are no publications for Histamine H3R Antibody (NBP3-16202).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Histamine H3R Antibody (NBP3-16202) (0)
There are no reviews for Histamine H3R Antibody (NBP3-16202).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Histamine H3R Antibody (NBP3-16202) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Histamine H3R Products
Research Areas for Histamine H3R Antibody (NBP3-16202)
Find related products by research area.
|
Blogs on Histamine H3R