Histamine H3R Antibody (7H8E6)

Western Blot: Histamine H3R Antibody (7H8E6) [NBP3-16202] - Western blot analysis of various lysates using Histamine H3R Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3min.

Immunoprecipitation: Histamine H3R Antibody (7H8E6) [NBP3-16202] - Immunoprecipitation analysis of 300 ug extracts of Raji cells using 3 ug Histamine H3R antibody. Western blot was performed from the immunoprecipitate using Histamine H3R antibody at a dilution of 1:1000.

Western Blot: Histamine H3R Antibody (7H8E6) [NBP3-16202] - Western blot analysis of various lysates using Histamine H3R Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clone: 7H8E6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Histamine H3R Antibody (7H8E6) Summary

• Description: Novus Biologicals Rabbit Histamine H3R Antibody (7H8E6) (NBP3-16202) is a recombinant monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histamine H3R (Q9Y5N1). MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFVADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRW
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HRH3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Histamine H3R Antibody (7H8E6)

• GPCR97
• GPCR97G protein-coupled receptor 97
• G-protein coupled receptor 97
• H3R
• HH3R
• Histamine H3 R
• histamine H3 receptor
• Histamine H3R
• histamine receptor H3
• HRH3

Background

H3 Histamine Receptor regulates the release of the neurotransmitters norepinephrine and somatostatin. In histamine-containing neurons of the brain, the H3 receptor acts as a presynaptic autoreceptor, while in nonhistamine-containing neurons in both the central and peripheral nervous systems, it acts as a presynaptic heteroreceptor. Multiple isoforms of H3 receptors are produced by alternative splicing. Histamine H3 receptor has been reported primarily in brain. ESTs have been isolated from brain (normal and cancer), breast cancer, colon cancer, and retinoblastoma libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HRH3