HIST1H2AC Antibody (4F10)


ELISA: HIST1H2AC Antibody (4F10) [H00008334-M01] - Detection limit for recombinant GST tagged HIST1H2AC is 0.1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA

Order Details

HIST1H2AC Antibody (4F10) Summary

HIST1H2AC (NP_003503, 25 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
HIST1H2AC - histone 1, H2ac
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


Application Notes
Antibody reactivity against recombinant protein on ELISA.
Read Publications using
H00008334-M01 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIST1H2AC Antibody (4F10)

  • dJ221C16.4
  • H2A/l
  • H2AFLmember L
  • histone 1, H2ac
  • histone cluster 1, H2ac
  • histone H2A type 1-C
  • Histone H2A/l
  • histone H2AC
  • MGC99519


Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
Species: Hu
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB

Publications for HIST1H2AC Antibody (H00008334-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ELISA, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for HIST1H2AC Antibody (H00008334-M01) (0)

There are no reviews for HIST1H2AC Antibody (H00008334-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HIST1H2AC Antibody (H00008334-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HIST1H2AC Products

Bioinformatics Tool for HIST1H2AC Antibody (H00008334-M01)

Discover related pathways, diseases and genes to HIST1H2AC Antibody (H00008334-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIST1H2AC Antibody (H00008334-M01)

Discover more about diseases related to HIST1H2AC Antibody (H00008334-M01).

Pathways for HIST1H2AC Antibody (H00008334-M01)

View related products by pathway.

Research Areas for HIST1H2AC Antibody (H00008334-M01)

Find related products by research area.

Blogs on HIST1H2AC

There are no specific blogs for HIST1H2AC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HIST1H2AC Antibody (4F10) and receive a gift card or discount.


Gene Symbol HIST1H2AC