HIPK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HIPK1 Antibody [NBP1-82981] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: HIPK1 Antibody [NBP1-82981] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIPK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQANSSHQVANFNIPAYDQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVDSNGSVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIPK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HIPK1 Protein (NBP1-82981PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HIPK1 Antibody

  • EC 2.7.11.1
  • HIPK1
  • homeodomain interacting protein kinase 1
  • homeodomain interacting protein kinase 1-like protein
  • homeodomain-interacting protein kinase 1
  • KIAA0630MGC26642
  • MGC33446
  • MGC33548
  • Myak
  • Nbak2
  • nuclear body associated kinase 2b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-24521
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC-P, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC

Publications for HIPK1 Antibody (NBP1-82981) (0)

There are no publications for HIPK1 Antibody (NBP1-82981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIPK1 Antibody (NBP1-82981) (0)

There are no reviews for HIPK1 Antibody (NBP1-82981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HIPK1 Antibody (NBP1-82981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIPK1 Products

Bioinformatics Tool for HIPK1 Antibody (NBP1-82981)

Discover related pathways, diseases and genes to HIPK1 Antibody (NBP1-82981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIPK1 Antibody (NBP1-82981)

Discover more about diseases related to HIPK1 Antibody (NBP1-82981).
 

Pathways for HIPK1 Antibody (NBP1-82981)

View related products by pathway.

PTMs for HIPK1 Antibody (NBP1-82981)

Learn more about PTMs related to HIPK1 Antibody (NBP1-82981).
 

Research Areas for HIPK1 Antibody (NBP1-82981)

Find related products by research area.

Blogs on HIPK1

There are no specific blogs for HIPK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIPK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIPK1
Entrez