HIC5/TGFB1I1 Antibody

Images

 
Immunohistochemistry: HIC5/TGFB1I1 Antibody [NBP3-10498] - Immunohistochemical analysis of human tonsil lysate tissue at an antibody concentration of 5.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIC5/TGFB1I1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HIC5/TGFB1I1 (NP_057011). Peptide sequence PRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRS
Clonality
Polyclonal
Host
Rabbit
Gene
TGFB1I1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for HIC5/TGFB1I1 Antibody

  • Androgen receptor coactivator 55 kDa protein
  • androgen receptor coactivator ARA55
  • Androgen receptor-associated protein of 55 kDa
  • ARA55
  • ARA55Hydrogen peroxide-inducible clone 5 protein
  • HIC5
  • HIC-5
  • TGFB1I1
  • transforming growth factor beta 1 induced transcript 1
  • transforming growth factor beta-1-induced transcript 1 protein
  • TSC-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-67427
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-18136
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05251
Species: Hu, Mu
Applications: WB
NBP1-89021
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89549
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB600-1293
Species: Am, Bv, Ca, Ch, Hu, Mu, Rt, Tr
Applications: ICC/IF, IHC, IHC-Fr, Simple Western, Single-Cell Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-46085
Species: Hu
Applications: IHC, WB

Publications for HIC5/TGFB1I1 Antibody (NBP3-10498) (0)

There are no publications for HIC5/TGFB1I1 Antibody (NBP3-10498).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIC5/TGFB1I1 Antibody (NBP3-10498) (0)

There are no reviews for HIC5/TGFB1I1 Antibody (NBP3-10498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIC5/TGFB1I1 Antibody (NBP3-10498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIC5/TGFB1I1 Products

Bioinformatics Tool for HIC5/TGFB1I1 Antibody (NBP3-10498)

Discover related pathways, diseases and genes to HIC5/TGFB1I1 Antibody (NBP3-10498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIC5/TGFB1I1 Antibody (NBP3-10498)

Discover more about diseases related to HIC5/TGFB1I1 Antibody (NBP3-10498).
 

Pathways for HIC5/TGFB1I1 Antibody (NBP3-10498)

View related products by pathway.

PTMs for HIC5/TGFB1I1 Antibody (NBP3-10498)

Learn more about PTMs related to HIC5/TGFB1I1 Antibody (NBP3-10498).
 

Research Areas for HIC5/TGFB1I1 Antibody (NBP3-10498)

Find related products by research area.

Blogs on HIC5/TGFB1I1

There are no specific blogs for HIC5/TGFB1I1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIC5/TGFB1I1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGFB1I1