HHATL Antibody (2B7) Summary
| Immunogen |
HHATL (NP_065758.2, 157 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
HHATL |
| Purity |
Ascites |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In ascites fluid |
| Preservative |
No Preservative |
| Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for HHATL Antibody (2B7)
Background
Negatively regulates N-terminal palmitoylation of SHH by HHAT/SKN
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for HHATL Antibody (H00057467-M07A-200ul) (0)
There are no publications for HHATL Antibody (H00057467-M07A-200ul).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HHATL Antibody (H00057467-M07A-200ul) (0)
There are no reviews for HHATL Antibody (H00057467-M07A-200ul).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for HHATL Antibody (H00057467-M07A-200ul) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HHATL Products
Array H00057467-M07A-200ul
Blogs on HHATL