HHATL Antibody (2B7)

Product Discontinued

HHATL Antibody (2B7) Summary

• Immunogen: HHATL (NP_065758.2, 157 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HHATL
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In ascites fluid
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HHATL Antibody (2B7)

• C3orf3
• chromosome 3 open reading frame 3
• glycerol uptake/transporter homolog
• GUP1
• Hedgehog acyltransferase-like protein
• hedgehog acyltransferase-like
• KIAA1173GUP1, glycerol uptake/transporter homolog (yeast)
• MBOAT3
• membrane bound O-acyltransferase domain containing 3
• protein-cysteine N-palmitoyltransferase HHAT-like protein

Background

Negatively regulates N-terminal palmitoylation of SHH by HHAT/SKN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HHATL
• Entrez:
  • 57467(Human)
• OMIM:
  • 608116(Human)
• Uniprot:
  • NP_065758.2(Human)