Myomegalin Antibody

Images

 
Western Blot: Myomegalin Antibody [NBP1-84428] - Analysis in human cell lines U-251MG and A-549 using Anti-PDE4DIP antibody. Corresponding PDE4DIP RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: Myomegalin Antibody [NBP1-84428] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Western Blot: Myomegalin Antibody [NBP1-84428] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Myomegalin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVLSSNEATMQSMESLLRAKGLEVEQLSTTCQNLQWLKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEVEDLSATLLCKLGPGQSEIAEELCQRLQRKERMLQDLLSDRNKQVLEHEMEIQGLLQSVSTREQESQAAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE4DIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myomegalin Protein (NBP1-84428PEP)
Publications
Read Publication using NBP1-84428.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23430395)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myomegalin Antibody

  • Cardiomyopathy-associated protein 2
  • CMYA2
  • DKFZp781J054
  • KIAA0454
  • KIAA0477
  • MGC75440
  • MMGLcardiomyopathy associated 2
  • myomegalin
  • phosphodiesterase 4D interacting protein
  • Phosphodiesterase 4D-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89076
Species: Hu
Applications: IHC, IHC-P
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86791
Species: Hu
Applications: IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NB300-869
Species: Mu
Applications: WB, PEP-ELISA
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
MAB2806
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-49500
Species: Hu
Applications: IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-84428
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Myomegalin Antibody (NBP1-84428)(1)

Reviews for Myomegalin Antibody (NBP1-84428) (0)

There are no reviews for Myomegalin Antibody (NBP1-84428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myomegalin Antibody (NBP1-84428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myomegalin Products

Bioinformatics Tool for Myomegalin Antibody (NBP1-84428)

Discover related pathways, diseases and genes to Myomegalin Antibody (NBP1-84428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myomegalin Antibody (NBP1-84428)

Discover more about diseases related to Myomegalin Antibody (NBP1-84428).
 

Pathways for Myomegalin Antibody (NBP1-84428)

View related products by pathway.

PTMs for Myomegalin Antibody (NBP1-84428)

Learn more about PTMs related to Myomegalin Antibody (NBP1-84428).

Blogs on Myomegalin

There are no specific blogs for Myomegalin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myomegalin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE4DIP