HGK/MAP4K4 Recombinant Protein Antigen

Images

 
There are currently no images for HGK/MAP4K4 Protein (NBP1-84663PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HGK/MAP4K4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP4K4.

Source: E. coli

Amino Acid Sequence: AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSSI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP4K4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84663.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HGK/MAP4K4 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • FLH21957
  • FLJ10410
  • hepatocyte progenitor kinase-like/germinal center kinase-like kinase
  • HGK
  • HGKFLJ20373
  • HPK/GCK-like kinase HGK
  • KIAA0687
  • MAP4K4
  • MAPK/ERK kinase kinase kinase 4
  • MEK kinase kinase 4
  • MEKKK 4
  • MEKKK4
  • mitogen-activated protein kinase kinase kinase kinase 4
  • Nck-interacting kinase
  • NIKFLJ90111

Background

MAP4K4 is encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-56704
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
MAB3199
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB3468
Species: Hu
Applications: ICC, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-84663PEP
Species: Hu
Applications: AC

Publications for HGK/MAP4K4 Protein (NBP1-84663PEP) (0)

There are no publications for HGK/MAP4K4 Protein (NBP1-84663PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGK/MAP4K4 Protein (NBP1-84663PEP) (0)

There are no reviews for HGK/MAP4K4 Protein (NBP1-84663PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HGK/MAP4K4 Protein (NBP1-84663PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HGK/MAP4K4 Products

Research Areas for HGK/MAP4K4 Protein (NBP1-84663PEP)

Find related products by research area.

Blogs on HGK/MAP4K4

There are no specific blogs for HGK/MAP4K4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HGK/MAP4K4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K4