HGD Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to HGD(homogentisate 1,2-dioxygenase (homogentisate oxidase)) The peptide sequence was selected from the middle region of HGD.
Peptide sequence KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HGD |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for HGD Antibody - BSA Free
Background
Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26.Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for HGD Antibody (NBP1-55134) (0)
There are no publications for HGD Antibody (NBP1-55134).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HGD Antibody (NBP1-55134) (0)
There are no reviews for HGD Antibody (NBP1-55134).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HGD Antibody (NBP1-55134) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HGD Products
Research Areas for HGD Antibody (NBP1-55134)
Find related products by research area.
|
Blogs on HGD