HFE Antibody

Images

 
Western Blot: HFE Antibody [NBP1-83250] - Analysis in control (vector only transfected HEK293T lysate) and HFE over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HFE Antibody [NBP1-83250] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry: HFE Antibody [NBP1-83250] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HFE Antibody [NBP1-83250] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HFE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS
Specificity
Specificity of human HFE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HFE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HFE Protein (NBP1-83250PEP)
Publications
Read Publication using NBP1-83250.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23991213)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HFE Antibody

  • dJ221C16.10.1
  • hemochromatosis
  • hereditary hemochromatosis protein HLA-H
  • hereditary hemochromatosis protein
  • HFE
  • HFE1
  • HH
  • high Fe
  • HLAH
  • HLA-H
  • HLA-HHFE1
  • MGC103790
  • MHC class I-like protein HFE
  • MVCD7
  • TFQTL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC
NBP1-59337
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS2666
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NLS2666
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
MAB3120
Species: Hu
Applications: WB, Simple Western
AF3720
Species: Hu, Mu
Applications: WB, ICC
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
AF3635
Species: Mu
Applications: WB, IHC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-80532
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-47791
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for HFE Antibody (NBP1-83250)(1)

Reviews for HFE Antibody (NBP1-83250) (0)

There are no reviews for HFE Antibody (NBP1-83250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HFE Antibody (NBP1-83250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HFE Products

Bioinformatics Tool for HFE Antibody (NBP1-83250)

Discover related pathways, diseases and genes to HFE Antibody (NBP1-83250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HFE Antibody (NBP1-83250)

Discover more about diseases related to HFE Antibody (NBP1-83250).
 

Pathways for HFE Antibody (NBP1-83250)

View related products by pathway.

PTMs for HFE Antibody (NBP1-83250)

Learn more about PTMs related to HFE Antibody (NBP1-83250).

Blogs on HFE.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HFE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HFE